Pages

Thursday, January 28, 2021

USS Enterprise, the "Galloping Ghost" of WWII

The Galloping Ghost!

USS Enterprise during World War II worldwartwo.filminspector.com
The USS Enterprise in 1939.
The “Big E" USS Enterprise (CV-6) fleet carrier of World War II fame was the 7th US Navy boat/ship named the Enterprise. The first was a sloop captured by none other than Benedict Arnold on Lake Champlain during the Revolutionary War. Other USS Enterprises were US Navy men of war, including a wooden ship involved in the Barbary Wars. Other Enterprises were Privateers, simple patrol craft. All of these predecessors ultimately led to the "Big E."
USS Enterprise during World War II worldwartwo.filminspector.com
USS Enterprise dodges bombs during the Battle of Santa Cruz, 26 October 1942.
The Enterprise was a Yorktown-class aircraft carrier that formed the mainstay of US Naval operations in the Pacific right from the start of the US involvement in World War 2. A little-known fact is that Enterprise sent 18 Douglas SBD Dauntless dive bombers of her Air Group over Pearl Harbor during the 7 December 1941 attack from a position about 215 nautical miles (398 km) west of Oahu. While not in a position to intercept the Japanese carrier force to the north of Oahu (whose whereabouts, in any event, were unknown), Enterprise still did her part in the battle. Seven of her planes were shot down with eight airmen killed and two wounded. The tale of the "missing US carriers," thus, is a pure myth. The US carriers were almost back at Pearl Harbor after delivering planes to Wake Island and were nearby during the attack, always ready for action. 
USS Enterprise during World War II worldwartwo.filminspector.com
USS Enterprise barely escapes destruction at the Battle of Santa Cruz, 26 October 1942.
USS Enterprise was credited with the first US Navy sinking of a full-sized Japanese ship during the war. This was the submarine I-70, sunk by Enterprise planes on 10 December 1941. Enterprise had an advantage over the Japanese because it carried the early RCA CXAM-1 radar and could spot the enemy electronically while the Japanese by and large relied on air patrols and lookouts. 
USS Enterprise during World War II worldwartwo.filminspector.com
Battle damage to Enterprise during the Battle of Santa Cruz.
In April 1942, Enterprise embarked on her most famous operation. Admiral William "Bull" Halsey commanded Task Force 16 from aboard the Enterprise and led it on the daring Doolittle Raid of 18 April 1942. While USS Hornet actually launched the 16 B-25 bombers that carried out the raid, Enterprise's planes provided crucial air cover and sank two nosy Japanese patrol boats that could have exposed the operation before it even began. Enterprise and Hornet then escaped unscathed in one of the most pivotal and successful naval operations of the war. The raid demolished 112 buildings and damaged 53 more, killing 87 men, women, and children. There were 151 civilians seriously injured, one being a woman shot through the face and thigh while gathering shellfish near Nagoya. Another 311 Japanese suffered minor injuries.
USS Enterprise during World War II worldwartwo.filminspector.com
A photo taken from the battleship Washington shows an explosion on Enterprise from a bomb-laden kamikaze. The ship's forward elevator was blown approximately 400 feet (120 m) into the air from the force of the explosion six decks below (U.S. Navy Naval History and Heritage Command Official U.S. Navy photo 80-G-323565).
One operation alone, however, does not tell the full story. The Enterprise was crowned with glory during World War 2, accumulating 20 Battlestars overall (the most ever for a US Navy ship). Among other exploits, she and her planes were credited with shooting down 911 enemy planes, sinking 71 ships, and damaging 192 other ships.
USS Enterprise during World War II worldwartwo.filminspector.com
Enterprise's massive elevator was destroyed by a Kamakazi.
All of the glory came at a heavy cost. The Big E accumulated its share of war damage and at times barely escaped being sunk. Enterprise was heavily damaged by bombs twice in the Solomon Islands and in the battle of Santa Cruz. She was struck twice by Kamakazis, with one explosion blowing her 15-ton elevator hundreds of feet into the air.
USS Enterprise during World War II worldwartwo.filminspector.com
A wall of flame rises over USS Enterprise during the Battle of Santa Cruz, 26 October 1942.
Throughout the war, Enterprise was reported as having been sunk by the Japanese three times. She came so close to destruction without falling over the edge and came and went without detection that Admiral Bull Halsey nicknamed her “The Galloping Ghost” of the Oahu coast. While heavy cruiser USS Houston (CA-30) acquired the same nickname during its activities off the Java coast, Enterprise was the most renowned ship to use that nickname.
In 1943 the Big E returned to the States for a complete overhaul after the Essex class carriers began to arrive. The Enterprise later returned to the Pacific and was involved in the Okinawa campaign and attacks on the main Islands of Japan.
USS Enterprise during World War II worldwartwo.filminspector.com
TBD-1 of VT-6 on the flight deck of USS Enterprise during the Doolittle Raid operation, 11 April 11 1942.

The End - and A Proud Heritage.

The USS Enterprise CV6 was one of only three original fleet carriers to survive the war. She was partially repaired for her late-war damage after entering the New York Naval Shipyard on 18 January 1946. Thereafter, was deactivated and decommissioned on 17 February 1947. After being mothballed until 1958, Enterprise was sold for $563k to the Lipsett Corporation of New York City for scrapping at Kearny, New Jersey. Instructions were that it was to be "scrapped only," so there was no possibility of revival.
USS Enterprise during World War II worldwartwo.filminspector.com
The Galloping Ghost finally heading to the scrapyard in 1958.
The "Galloping Ghost's" heritage continues long after its scrapping. The eighth Enterprise was the world's first nuclear-powered carrier and served honorably from November 1961 to 1 December 2012. The ninth Enterprise is currently under construction as of 2021.
USS Enterprise during World War II worldwartwo.filminspector.com

2021

Monday, January 18, 2021

B-17 Sequence From "Heavy Metal" (1981)

Heavy Metal Indeed

B-17 scene Heavy Metal worldwartwo.filminspector.com
A B-17 figures prominently in "Heavy Metal" (1981).
"Heavy Metal" (1981) was a Canadian-American animated feature film directed toward an adult audience. Directed by Gerald Potterton and produced by Ivan Reitman and Leonard Mogel, it is composed of a series of loosely connected vignettes. These scenes don't have much connection to each other aside from a murky framing device involving some kind of alien force. One of the best scenes is set somewhat incongruously during World War II aboard a USAAF B-17 bomber in the South Pacific.
Heavy Metal (1981) animatedfilmreviews.filminwpctor.com
The B-17 story is tight and surprisingly realistic despite the supernatural theme.
The animators drawing the different scenes basically went where they wanted to go without much regard to an overall plot. The B-17 story, written by Dan O'Bannon of "Alien" fame, apparently was drawn by a World War II veteran who just wanted to tell a supernatural tale from that conflict based on his own experiences - and things branch off in different directions from there.
Heavy Metal (1981) animatedfilmreviews.filminwpctor.com
"Heavy Metal" thus features creativity run wild, which either comports with what you want from an animated feature film or doesn't. Any fan of animation should get a thrill out of it. I think this scene is interesting as a kind of hallucinogenic fantasy memory of World War II. And, it's just plain fun.
B-17 scene Heavy Metal worldwartwo.filminspector.com
The musical track that accompanies this part of the scene is by Don Felder of the Eagles. Oh, and before you hunt down the movie, just be aware that the rest of it has nothing whatsoever to do with B-17s or bombers in any way, shape, or form. Anyway, this is just a break from the usual historical heavy lifting on this blog, something a little fun. I hope you enjoy this selection! If you wish to learn more about "Heavy Metal," I have a page devoted to it here.

2021